AKAP10 antibody (70R-3447)

Rabbit polyclonal AKAP10 antibody

Synonyms Polyclonal AKAP10 antibody, Anti-AKAP10 antibody, AKAP antibody, A-kinase anchoring protein 10 antibody, D-AKAP2 antibody, Prka Anchor Protein 10 antibody, PRKA10 antibody, MGC9414 antibody
Cross Reactivity Human
Applications WB
Immunogen AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
Assay Information AKAP10 Blocking Peptide, catalog no. 33R-2735, is also available for use as a blocking control in assays to test for specificity of this AKAP10 antibody


Western Blot analysis using AKAP10 antibody (70R-3447)

AKAP10 antibody (70R-3447) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AKAP10 antibody (70R-3447) | AKAP10 antibody (70R-3447) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors