AKAP8 Blocking Peptide (33R-1721)

A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP8 antibody, catalog no. 70R-7946

Synonyms AKAP8 control peptide, AKAP8 antibody Blocking Peptide, Anti-AKAP8 Blocking Peptide, A kinase, PRKA anchor protein 8 Blocking Peptide, AKAP95 Blocking Peptide, DKFZp586B1222 Blocking Peptide, AKAP8, AKAP-8, AKAP 8, AKAP-8 Blocking Peptide, AKAP 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP8 is a member of the AKAP family. It is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors