AKR1C2 antibody (70R-4046)

Rabbit polyclonal AKR1C2 antibody

Synonyms Polyclonal AKR1C2 antibody, Anti-AKR1C2 antibody, AKR1C-pseudo antibody, DD2 antibody, MCDR2 antibody, BABP antibody, Bile Acid Binding protein antibody, DDH2 antibody, Aldo-Keto Reductase Family 1 Member C2 antibody, DD antibody, Dihydrodiol Dehydrogenase 2 antibody, HAKRD antibody, 3-alpha hydroxysteroid dehydrogenase type III antibody, HBAB antibody
Cross Reactivity Human
Applications WB
Immunogen AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
Assay Information AKR1C2 Blocking Peptide, catalog no. 33R-1968, is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody

Western Blot analysis using AKR1C2 antibody (70R-4046)

AKR1C2 antibody (70R-4046) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKR1C2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using AKR1C2 antibody (70R-4046) | AKR1C2 antibody (70R-4046) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors