AKR7A3 antibody (70R-4223)

Rabbit polyclonal AKR7A3 antibody

Synonyms Polyclonal AKR7A3 antibody, Anti-AKR7A3 antibody, Aldo-Keto Reductase Family 7 Member A3 antibody, Aflatoxin Aldehyde Reductase antibody, AFAR2 antibody
Cross Reactivity Human
Applications WB
Immunogen AKR7A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
Assay Information AKR7A3 Blocking Peptide, catalog no. 33R-9513, is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody

Images

Western Blot analysis using AKR7A3 antibody (70R-4223)

AKR7A3 antibody (70R-4223) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKR7A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AKR7A3 antibody (70R-4223) | AKR7A3 antibody (70R-4223) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors