ALAD antibody (70R-3444)

Rabbit polyclonal ALAD antibody raised against the N terminal of ALAD

Synonyms Polyclonal ALAD antibody, Anti-ALAD antibody, MGC5057 antibody, Aminolevulinate Delta- Dehydratase antibody, PBGS antibody, ALADH antibody
Specificity ALAD antibody was raised against the N terminal of ALAD
Cross Reactivity Human
Applications WB
Immunogen ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP
Assay Information ALAD Blocking Peptide, catalog no. 33R-7682, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Images

Western Blot analysis using ALAD antibody (70R-3444)

ALAD antibody (70R-3444) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALAD antibody (70R-3444) | ALAD antibody (70R-3444) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors