ALAS2 antibody (70R-2481)

Rabbit polyclonal ALAS2 antibody raised against the N terminal of ALAS2

Synonyms Polyclonal ALAS2 antibody, Anti-ALAS2 antibody, XLSA antibody, Aminolevulinate Delta- Synthase 2 antibody, ASB antibody, ANH1 antibody
Specificity ALAS2 antibody was raised against the N terminal of ALAS2
Cross Reactivity Human,Mouse
Applications WB
Immunogen ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK
Assay Information ALAS2 Blocking Peptide, catalog no. 33R-1765, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody


Western Blot analysis using ALAS2 antibody (70R-2481)

ALAS2 antibody (70R-2481) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALAS2 antibody (70R-2481) | ALAS2 antibody (70R-2481) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors