ALDH1A1 antibody (70R-4584)

Rabbit polyclonal ALDH1A1 antibody raised against the middle region of ALDH1A1

Synonyms Polyclonal ALDH1A1 antibody, Anti-ALDH1A1 antibody, PUMB1 antibody, RALDH1 antibody, MGC2318 antibody, ALDH1 antibody, ALDC antibody, ALDH11 antibody, Aldehyde Dehydrogenase 1 Family Member A1 antibody, ALDH-E1 antibody
Specificity ALDH1A1 antibody was raised against the middle region of ALDH1A1
Cross Reactivity Human
Applications WB
Immunogen ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG
Assay Information ALDH1A1 Blocking Peptide, catalog no. 33R-8907, is also available for use as a blocking control in assays to test for specificity of this ALDH1A1 antibody


Immunofluorescent staining using ALDH1A1 antibody (70R-4584)

ALDH1A1 antibody used at a dilution of 1:200 to detect human cornea.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunofluorescent staining using ALDH1A1 antibody (70R-4584) | ALDH1A1 antibody used at a dilution of 1:200 to detect human cornea.
  • Western Blot analysis using ALDH1A1 antibody (70R-4584) | ALDH1A1 antibody (70R-4584) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors