ALDH1B1 antibody (70R-3238)

Rabbit polyclonal ALDH1B1 antibody raised against the middle region of ALDH1B1

Synonyms Polyclonal ALDH1B1 antibody, Anti-ALDH1B1 antibody, ALDHX antibody, MGC2230 antibody, Aldehyde Dehydrogenase 1 Family Member B1 antibody, ALDH5 antibody
Specificity ALDH1B1 antibody was raised against the middle region of ALDH1B1
Cross Reactivity Human
Applications WB
Immunogen ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
Assay Information ALDH1B1 Blocking Peptide, catalog no. 33R-3255, is also available for use as a blocking control in assays to test for specificity of this ALDH1B1 antibody


Western Blot analysis using ALDH1B1 antibody (70R-3238)

ALDH1B1 antibody (70R-3238) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALDH1B1 antibody (70R-3238) | ALDH1B1 antibody (70R-3238) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors