ALDH1L1 antibody (70R-3460)

Rabbit polyclonal ALDH1L1 antibody raised against the middle region of ALDH1L1

Synonyms Polyclonal ALDH1L1 antibody, Anti-ALDH1L1 antibody, FTHFD antibody, DKFZp781N0997 antibody, Aldehyde Dehydrogenase 1 Family Member L1 antibody
Specificity ALDH1L1 antibody was raised against the middle region of ALDH1L1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALDH1L1 antibody was raised using the middle region of ALDH1L1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
Assay Information ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody

Images

Western Blot analysis using ALDH1L1 antibody (70R-3460)

ALDH1L1 antibody (70R-3460) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALDH1L1 antibody (70R-3460) | ALDH1L1 antibody (70R-3460) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors