ALDH3A2 antibody (70R-6587)

Rabbit polyclonal ALDH3A2 antibody raised against the middle region of ALDH3A2

Synonyms Polyclonal ALDH3A2 antibody, Anti-ALDH3A2 antibody, Aldehyde Dehydrogenase 3 Family Member A2 antibody, DKFZp686E23276 antibody, SLS antibody, FLJ20851 antibody, ALDH10 antibody, FALDH antibody
Specificity ALDH3A2 antibody was raised against the middle region of ALDH3A2
Cross Reactivity Human
Applications WB
Immunogen ALDH3A2 antibody was raised using the middle region of ALDH3A2 corresponding to a region with amino acids DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
Assay Information ALDH3A2 Blocking Peptide, catalog no. 33R-1975, is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody

Images

Western Blot analysis using ALDH3A2 antibody (70R-6587)

ALDH3A2 antibody (70R-6587) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH3A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALDH3A2 antibody (70R-6587) | ALDH3A2 antibody (70R-6587) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors