ALDH6A1 antibody (70R-6488)

Rabbit polyclonal ALDH6A1 antibody raised against the middle region of ALDH6A1

Synonyms Polyclonal ALDH6A1 antibody, Anti-ALDH6A1 antibody, Aldehyde Dehydrogenase 6 Family Member A1 antibody, MMSADHA antibody, MMSDH antibody, MGC40271 antibody
Specificity ALDH6A1 antibody was raised against the middle region of ALDH6A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW
Assay Information ALDH6A1 Blocking Peptide, catalog no. 33R-3518, is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody


Western Blot analysis using ALDH6A1 antibody (70R-6488)

ALDH6A1 antibody (70R-6488) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH6A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALDH6A1 antibody (70R-6488) | ALDH6A1 antibody (70R-6488) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors