ALDH6A1 antibody (70R-6489)

Rabbit polyclonal ALDH6A1 antibody raised against the middle region of ALDH6A1

Synonyms Polyclonal ALDH6A1 antibody, Anti-ALDH6A1 antibody, MGC40271 antibody, MMSADHA antibody, MMSDH antibody, Aldehyde Dehydrogenase 6 Family Member A1 antibody
Specificity ALDH6A1 antibody was raised against the middle region of ALDH6A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID
Assay Information ALDH6A1 Blocking Peptide, catalog no. 33R-1606, is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Images

Western Blot analysis using ALDH6A1 antibody (70R-6489)

ALDH6A1 antibody (70R-6489) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH6A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALDH6A1 antibody (70R-6489) | ALDH6A1 antibody (70R-6489) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors