ALDH7A1 antibody (70R-4025)

Rabbit polyclonal ALDH7A1 antibody raised against the N terminal of ALDH7A1

Synonyms Polyclonal ALDH7A1 antibody, Anti-ALDH7A1 antibody, EPD antibody, ATQ1 antibody, PDE antibody, Aldehyde Dehydrogenase 7 Family Member A1 antibody
Specificity ALDH7A1 antibody was raised against the N terminal of ALDH7A1
Cross Reactivity Human
Applications WB
Immunogen ALDH7A1 antibody was raised using the N terminal of ALDH7A1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS
Assay Information ALDH7A1 Blocking Peptide, catalog no. 33R-6842, is also available for use as a blocking control in assays to test for specificity of this ALDH7A1 antibody


Western Blot analysis using ALDH7A1 antibody (70R-4025)

ALDH7A1 antibody (70R-4025) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH7A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALDH7A1 antibody (70R-4025) | ALDH7A1 antibody (70R-4025) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors