ALDOC antibody (70R-2334)

Rabbit polyclonal ALDOC antibody raised against the N terminal of ALDOC

Synonyms Polyclonal ALDOC antibody, Anti-ALDOC antibody, ALDC antibody, Aldolase C Fructose-Bisphosphate antibody
Specificity ALDOC antibody was raised against the N terminal of ALDOC
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
Assay Information ALDOC Blocking Peptide, catalog no. 33R-6286, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Images

Western Blot analysis using ALDOC antibody (70R-2334)

ALDOC antibody (70R-2334) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALDOC antibody (70R-2334) | ALDOC antibody (70R-2334) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors