ALG1 antibody (70R-7346)

Rabbit polyclonal ALG1 antibody raised against the N terminal of ALG1

Synonyms Polyclonal ALG1 antibody, Anti-ALG1 antibody, HMT1 antibody, HMAT1 antibody, HMT-1 antibody, Asparagine-Linked Glycosylation 1 Homolog antibody
Specificity ALG1 antibody was raised against the N terminal of ALG1
Cross Reactivity Human
Applications WB
Immunogen ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG
Assay Information ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody

Images

Western Blot analysis using ALG1 antibody (70R-7346)

ALG1 antibody (70R-7346) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALG1 antibody (70R-7346) | ALG1 antibody (70R-7346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors