ALG11 antibody (70R-6417)

Rabbit polyclonal ALG11 antibody raised against the C terminal of ALG11

Synonyms Polyclonal ALG11 antibody, Anti-ALG11 antibody, GT8 antibody, Asparagine-Linked Glycosylation 11 Homolog antibody, KIAA0266 antibody
Specificity ALG11 antibody was raised against the C terminal of ALG11
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Assay Information ALG11 Blocking Peptide, catalog no. 33R-5030, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Images

Immunohistochemical staining using ALG11 antibody (70R-6417)

ALG11 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALG11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ALG11 antibody (70R-6417) | ALG11 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ALG11 antibody (70R-6417) | ALG11 antibody (70R-6417) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors