ALG11 antibody (70R-6422)

Rabbit polyclonal ALG11 antibody yeast alpha-12-mannosyltransferase

Synonyms Polyclonal ALG11 antibody, Anti-ALG11 antibody, KIAA0266 antibody, GT8 antibody, Asparagine-Linked Glycosylation 11 Homolog antibody
Specificity ALG11 antibody was yeast alpha-12-mannosyltransferase
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA
Assay Information ALG11 Blocking Peptide, catalog no. 33R-5418, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Images

Western Blot analysis using ALG11 antibody (70R-6422)

ALG11 antibody (70R-6422) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALG11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALG11 antibody (70R-6422) | ALG11 antibody (70R-6422) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors