ALG6 antibody (70R-7343)

Rabbit polyclonal ALG6 antibody

Synonyms Polyclonal ALG6 antibody, Anti-ALG6 antibody, Asparagine-Linked Glycosylation 6 Homolog antibody, S. Cerevisiae Alpha-13-Glucosyltransferase antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA
Assay Information ALG6 Blocking Peptide, catalog no. 33R-10079, is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody

Images

Western Blot analysis using ALG6 antibody (70R-7343)

ALG6 antibody (70R-7343) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALG6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALG6 antibody (70R-7343) | ALG6 antibody (70R-7343) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors