ALLC antibody (70R-3698)

Rabbit polyclonal ALLC antibody raised against the N terminal of ALLC

Synonyms Polyclonal ALLC antibody, Anti-ALLC antibody, Allantoicase antibody, ALC antibody
Specificity ALLC antibody was raised against the N terminal of ALLC
Cross Reactivity Human
Applications WB
Immunogen ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
Assay Information ALLC Blocking Peptide, catalog no. 33R-9608, is also available for use as a blocking control in assays to test for specificity of this ALLC antibody

Images

Western Blot analysis using ALLC antibody (70R-3698)

ALLC antibody (70R-3698) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALLC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALLC antibody (70R-3698) | ALLC antibody (70R-3698) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors