ALOX12 antibody (70R-3235)

Rabbit polyclonal ALOX12 antibody raised against the C terminal of ALOX12

Synonyms Polyclonal ALOX12 antibody, Anti-ALOX12 antibody, Arachidonate 12-Lipoxygenase antibody, LOG12 antibody, 12-LOX antibody
Specificity ALOX12 antibody was raised against the C terminal of ALOX12
Cross Reactivity Human
Applications WB
Immunogen ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
Assay Information ALOX12 Blocking Peptide, catalog no. 33R-6077, is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody

Images

Western Blot analysis using ALOX12 antibody (70R-3235)

ALOX12 antibody (70R-3235) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALOX12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALOX12 antibody (70R-3235) | ALOX12 antibody (70R-3235) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors