ALOX15 antibody (70R-5828)

Rabbit polyclonal ALOX15 antibody raised against the middle region of ALOX15

Synonyms Polyclonal ALOX15 antibody, Anti-ALOX15 antibody, Arachidonate 15-Lipoxygenase antibody, 15-LOX2 antibody
Specificity ALOX15 antibody was raised against the middle region of ALOX15
Cross Reactivity Human
Applications WB
Immunogen ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
Assay Information ALOX15 Blocking Peptide, catalog no. 33R-7578, is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody

Images

Western Blot analysis using ALOX15 antibody (70R-5828)

ALOX15 antibody (70R-5828) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALOX15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALOX15 antibody (70R-5828) | ALOX15 antibody (70R-5828) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors