alpha Actinin 2 antibody (70R-2259)

Rabbit polyclonal alpha Actinin 2 antibody raised against the N terminal of ACTN2

Synonyms Polyclonal alpha Actinin 2 antibody, Anti-alpha Actinin 2 antibody, ACTN2 antibody
Specificity Alpha Actinin 2 antibody was raised against the N terminal of ACTN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
Assay Information Alpha Actinin 2 Blocking Peptide, catalog no. 33R-6838, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Images

Western Blot analysis using Alpha Actinin 2 antibody (70R-2259)

Alpha Actinin 2 antibody (70R-2259) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Alpha Actinin 2 antibody (70R-2259) | Alpha Actinin 2 antibody (70R-2259) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors