alpha Tubulin 3C antibody (70R-2123)

Rabbit polyclonal alpha Tubulin 3C antibody raised against the N terminal of TUBA3C

Synonyms Polyclonal alpha Tubulin 3C antibody, Anti-alpha Tubulin 3C antibody, bA408E5.3 antibody, TUBA2 antibody, TUBA3C antibody
Specificity alpha Tubulin 3C antibody was raised against the N terminal of TUBA3C
Cross Reactivity Human,Mouse,Rat,Arabidopsis,Drosophila
Applications WB
Immunogen alpha Tubulin 3C antibody was raised using the N terminal of TUBA3C corresponding to a region with amino acids QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR
Assay Information alpha Tubulin 3C Blocking Peptide, catalog no. 33R-7656, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody


Western Blot analysis using alpha Tubulin 3C antibody (70R-2123)

alpha Tubulin 3C antibody (70R-2123) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBA3C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using alpha Tubulin 3C antibody (70R-2123) | alpha Tubulin 3C antibody (70R-2123) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors