ALPP antibody (70R-1570)

Rabbit polyclonal ALPP antibody

Synonyms Polyclonal ALPP antibody, Anti-ALPP antibody, Regan Isozyme antibody, Alkaline Phosphatase Placental antibody, ALP antibody, PLAP antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Assay Information ALPP Blocking Peptide, catalog no. 33R-9362, is also available for use as a blocking control in assays to test for specificity of this ALPP antibody

Images

Immunohistochemical staining using ALPP antibody (70R-1570)

ALPP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ALPP antibody (70R-1570) | ALPP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using ALPP antibody (70R-1570) | ALPP antibody (70R-1570) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors