ALPPL2 antibody (70R-5382)

Rabbit polyclonal ALPPL2 antibody raised against the middle region of ALPPL2

Synonyms Polyclonal ALPPL2 antibody, Anti-ALPPL2 antibody, GCAP antibody, ALPPL antibody, Alkaline Phosphatase Placental-Like 2 antibody, ALPG antibody
Specificity ALPPL2 antibody was raised against the middle region of ALPPL2
Cross Reactivity Human
Applications WB
Immunogen ALPPL2 antibody was raised using the middle region of ALPPL2 corresponding to a region with amino acids SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
Assay Information ALPPL2 Blocking Peptide, catalog no. 33R-8403, is also available for use as a blocking control in assays to test for specificity of this ALPPL2 antibody

Images

Western Blot analysis using ALPPL2 antibody (70R-5382)

ALPPL2 antibody (70R-5382) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALPPL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALPPL2 antibody (70R-5382) | ALPPL2 antibody (70R-5382) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors