ALS2CR12 antibody (70R-3279)

Rabbit polyclonal ALS2CR12 antibody

Synonyms Polyclonal ALS2CR12 antibody, Anti-ALS2CR12 antibody, Juvenile Chromosome Region Candidate 12 antibody, Amyotrophic Lateral Sclerosis 2 antibody
Cross Reactivity Human
Applications WB
Immunogen ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP
Assay Information ALS2CR12 Blocking Peptide, catalog no. 33R-8818, is also available for use as a blocking control in assays to test for specificity of this ALS2CR12 antibody

Images

Western Blot analysis using ALS2CR12 antibody (70R-3279)

ALS2CR12 antibody (70R-3279) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALS2CR12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ALS2CR12 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALS2CR12 antibody (70R-3279) | ALS2CR12 antibody (70R-3279) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors