AMH antibody (70R-6224)

Rabbit polyclonal AMH antibody raised against the middle region of AMH

Synonyms Polyclonal AMH antibody, Anti-AMH antibody, Anti Mullerian Hormone antibody, MIF antibody, MIS antibody
Specificity AMH antibody was raised against the middle region of AMH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
Assay Information AMH Blocking Peptide, catalog no. 33R-8906, is also available for use as a blocking control in assays to test for specificity of this AMH antibody

Images

Immunohistochemical staining using AMH antibody (70R-6224)

AMH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using AMH antibody (70R-6224) | AMH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using AMH antibody (70R-6224) | AMH antibody (70R-6224) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors