Amphiphysin antibody (70R-3809)

Rabbit polyclonal Amphiphysin antibody raised against the N terminal of AMPH

Synonyms Polyclonal Amphiphysin antibody, Anti-Amphiphysin antibody, AMPH antibody, AMPH1 antibody
Specificity Amphiphysin antibody was raised against the N terminal of AMPH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA
Assay Information Amphiphysin Blocking Peptide, catalog no. 33R-1095, is also available for use as a blocking control in assays to test for specificity of this Amphiphysin antibody

Images

Western Blot analysis using Amphiphysin antibody (70R-3809)

Amphiphysin antibody (70R-3809) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Amphiphysin antibody (70R-3809) | Amphiphysin antibody (70R-3809) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors