Amphiphysin Blocking Peptide (33R-1095)

A synthetic peptide for use as a blocking control in assays to test for specificity of AMPH antibody, catalog no. 70R-3809

Synonyms Amphiphysin control peptide, Amphiphysin antibody Blocking Peptide, Anti-Amphiphysin Blocking Peptide, AMPH Blocking Peptide, AMPH1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA
Molecular Weight 76 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors