AMT antibody (70R-2513)

Rabbit polyclonal AMT antibody raised against the N terminal of AMT

Synonyms Polyclonal AMT antibody, Anti-AMT antibody, NKH antibody, GCE antibody, Aminomethyltransferase antibody, GCST antibody
Specificity AMT antibody was raised against the N terminal of AMT
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA
Assay Information AMT Blocking Peptide, catalog no. 33R-7703, is also available for use as a blocking control in assays to test for specificity of this AMT antibody


Western Blot analysis using AMT antibody (70R-2513)

AMT antibody (70R-2513) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The enzyme system for cleavage of glycine (glycine cleavage system; EC, which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AMT antibody (70R-2513) | AMT antibody (70R-2513) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors