AMZ2 Blocking Peptide (33R-1072)

A synthetic peptide for use as a blocking control in assays to test for specificity of AMZ2 antibody, catalog no. 70R-9376

Synonyms AMZ2 control peptide, AMZ2 antibody Blocking Peptide, Anti-AMZ2 Blocking Peptide, archaelysin family metallopeptidase 2 Blocking Peptide, AMZ2, AMZ-2, AMZ 2, AMZ-2 Blocking Peptide, AMZ 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AMZ2 is a Zinc metalloprotease. Exhibits activity against angiotensin-3 in vitro. Does not hydrolyze either neurogranin or angiotensin-2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors