ANAPC10 antibody (70R-5616)

Rabbit polyclonal ANAPC10 antibody raised against the N terminal of ANAPC10

Synonyms Polyclonal ANAPC10 antibody, Anti-ANAPC10 antibody, DKFZP564L0562 antibody, Anaphase Promoting Complex Subunit 10 antibody, APC10 antibody, DOC1 antibody
Specificity ANAPC10 antibody was raised against the N terminal of ANAPC10
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
Assay Information ANAPC10 Blocking Peptide, catalog no. 33R-6569, is also available for use as a blocking control in assays to test for specificity of this ANAPC10 antibody

Images

Western Blot analysis using ANAPC10 antibody (70R-5616)

ANAPC10 antibody (70R-5616) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANAPC10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANAPC10 antibody (70R-5616) | ANAPC10 antibody (70R-5616) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors