Angiogenin protein (His tag) (80R-3459)

Purified recombinant Angiogenin protein (His tag)

Synonyms Ribonuclease 5 protein, Nase 5 protein, Ang protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using Angiogenin protein (His tag) (80R-3459)

Specifications

Residues MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD QSIFRRP
Expression System E.coli
Source His-fusion expressed as an inclusion body
Purity > 90% pure
Molecular Weight 20 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance Angiogenin may function as a tRNA-specific ribonuclease that abolishes protein synthesis by specifically hydrolyzing cellular tRNAs. Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Angiogenin protein (His tag) (80R-3459)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors