ANGPT4 antibody (70R-5269)

Rabbit polyclonal ANGPT4 antibody raised against the N terminal of ANGPT4

Synonyms Polyclonal ANGPT4 antibody, Anti-ANGPT4 antibody, Angiopoietin 4 antibody, ANG-3 antibody, Angiopoietin -4, MGC138181 antibody, Angiopoietin 4 antibody, Angiopoietin 4, Angiopoietin 4, ANG4 antibody, MGC138183 antibody, Angiopoietin -4 antibody, AGP4 antibody
Specificity ANGPT4 antibody was raised against the N terminal of ANGPT4
Cross Reactivity Human
Applications WB
Immunogen ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Assay Information ANGPT4 Blocking Peptide, catalog no. 33R-9193, is also available for use as a blocking control in assays to test for specificity of this ANGPT4 antibody

Images

Western Blot analysis using ANGPT4 antibody (70R-5269)

ANGPT4 antibody (70R-5269) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANGPT4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANGPT4 antibody (70R-5269) | ANGPT4 antibody (70R-5269) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors