ANKH antibody (70R-6654)

Rabbit polyclonal ANKH antibody

Synonyms Polyclonal ANKH antibody, Anti-ANKH antibody, Ankylosis Progressive Homolog antibody, ANK antibody, MANK antibody, CCAL2 antibody, HANK antibody, CPPDD antibody, CMDJ antibody, FLJ27166 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ANKH antibody was raised using a synthetic peptide corresponding to a region with amino acids SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK
Assay Information ANKH Blocking Peptide, catalog no. 33R-8361, is also available for use as a blocking control in assays to test for specificity of this ANKH antibody

Images

Western Blot analysis using ANKH antibody (70R-6654)

ANKH antibody (70R-6654) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKH antibody (70R-6654) | ANKH antibody (70R-6654) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors