ANKRD42 antibody (70R-4932)

Rabbit polyclonal ANKRD42 antibody raised against the N terminal of ANKRD42

Synonyms Polyclonal ANKRD42 antibody, Anti-ANKRD42 antibody, SARP antibody, FLJ37874 antibody, Ankyrin Repeat Domain 42 antibody
Specificity ANKRD42 antibody was raised against the N terminal of ANKRD42
Cross Reactivity Human
Applications WB
Immunogen ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW
Assay Information ANKRD42 Blocking Peptide, catalog no. 33R-6284, is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody


Western Blot analysis using ANKRD42 antibody (70R-4932)

ANKRD42 antibody (70R-4932) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKRD42 antibody (70R-4932) | ANKRD42 antibody (70R-4932) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors