ANKRD5 antibody (70R-3379)

Rabbit polyclonal ANKRD5 antibody raised against the N terminal of ANKRD5

Synonyms Polyclonal ANKRD5 antibody, Anti-ANKRD5 antibody, Ankyrin Repeat Domain 5 antibody, FLJ21669 antibody, dJ839B4.6 antibody
Specificity ANKRD5 antibody was raised against the N terminal of ANKRD5
Cross Reactivity Human
Applications WB
Immunogen ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA
Assay Information ANKRD5 Blocking Peptide, catalog no. 33R-6546, is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody


Western Blot analysis using ANKRD5 antibody (70R-3379)

ANKRD5 antibody (70R-3379) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKRD5 antibody (70R-3379) | ANKRD5 antibody (70R-3379) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors