ANKRD7 antibody (70R-3952)

Rabbit polyclonal ANKRD7 antibody raised against the middle region of ANKRD7

Synonyms Polyclonal ANKRD7 antibody, Anti-ANKRD7 antibody, TSA806 antibody, Ankyrin Repeat Domain 7 antibody
Specificity ANKRD7 antibody was raised against the middle region of ANKRD7
Cross Reactivity Human
Applications WB
Immunogen ANKRD7 antibody was raised using the middle region of ANKRD7 corresponding to a region with amino acids EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL
Assay Information ANKRD7 Blocking Peptide, catalog no. 33R-2817, is also available for use as a blocking control in assays to test for specificity of this ANKRD7 antibody

Images

Western Blot analysis using ANKRD7 antibody (70R-3952)

ANKRD7 antibody (70R-3952) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKRD7 antibody (70R-3952) | ANKRD7 antibody (70R-3952) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors