Annexin A10 antibody (70R-6037)

Rabbit polyclonal Annexin A10 antibody raised against the middle region of ANXA10

Synonyms Polyclonal Annexin A10 antibody, Anti-Annexin A10 antibody, Annexin A 10 antibody, Annexin A-10 antibody, ANXA10 antibody, ANX14 antibody, Annexin A-10, Annexin A10, Annexin A 10
Specificity Annexin A10 antibody was raised against the middle region of ANXA10
Cross Reactivity Human
Applications WB
Immunogen Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE
Assay Information Annexin A10 Blocking Peptide, catalog no. 33R-9693, is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody

Images

Western Blot analysis using Annexin A10 antibody (70R-6037)

Annexin A10 antibody (70R-6037) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANXA10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Annexin A10 antibody (70R-6037) | Annexin A10 antibody (70R-6037) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors