Annexin A13 antibody (70R-1674)

Rabbit polyclonal Annexin A13 antibody raised against the N terminal of ANXA13

Synonyms Polyclonal Annexin A13 antibody, Anti-Annexin A13 antibody, Annexin A-13 antibody, ANXA13 antibody, Annexin A 13 antibody, Annexin A13, Annexin A 13, Annexin A-13
Specificity Annexin A13 antibody was raised against the N terminal of ANXA13
Cross Reactivity Human, Dog
Applications WB
Immunogen Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS
Assay Information Annexin A13 Blocking Peptide, catalog no. 33R-4483, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody


Western blot analysis using Annexin A13 antibody (70R-1674)

Recommended ANXA13 Antibody Titration: 2.5ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using Annexin A13 antibody (70R-1674) | Recommended ANXA13 Antibody Titration: 2.5ug/ml

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors