Annexin A6 antibody (70R-1673)

Rabbit polyclonal Annexin A6 antibody raised against the N terminal of ANXA6

Synonyms Polyclonal Annexin A6 antibody, Anti-Annexin A6 antibody, Annexin A 6 antibody, Camb antibody, Annexin A 6, Annexin A-6 antibody, Annexin A-6, AW107198 antibody, Cabm antibody, AnxVI antibody, ANXA6 antibody, Annexin A6, Anx6 antibody
Specificity Annexin A6 antibody was raised against the N terminal of ANXA6
Cross Reactivity Human
Applications WB
Immunogen Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
Assay Information Annexin A6 Blocking Peptide, catalog no. 33R-1381, is also available for use as a blocking control in assays to test for specificity of this Annexin A6 antibody

Western Blot analysis using Annexin A6 antibody (70R-1673)

Annexin A6 antibody (70R-1673) used at 1.25 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using Annexin A6 antibody (70R-1673) | Annexin A6 antibody (70R-1673) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors