Annexin A8-Like 2 antibody (70R-6045)

Rabbit polyclonal Annexin A8-Like 2 antibody raised against the N terminal of ANXA8L2

Synonyms Polyclonal Annexin A8-Like 2 antibody, Anti-Annexin A8-Like 2 antibody, ANXA8 antibody, ANXA8L2 antibody, bA145E20.2 antibody, FLJ32754 antibody, Annexin A 8 antibody, Annexin A-8 antibody, Annexin A8, Annexin A-8, Annexin A 8
Specificity Annexin A8-Like 2 antibody was raised against the N terminal of ANXA8L2
Cross Reactivity Human
Applications WB
Immunogen Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET
Assay Information Annexin A8-Like 2 Blocking Peptide, catalog no. 33R-7004, is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody


Western Blot analysis using Annexin A8-Like 2 antibody (70R-6045)

Annexin A8-Like 2 antibody (70R-6045) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANXA8L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Annexin A8-Like 2 antibody (70R-6045) | Annexin A8-Like 2 antibody (70R-6045) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors