ANTP antibody (70R-2190)

Rabbit polyclonal ANTP antibody raised against the C terminal Of Antp

Synonyms Polyclonal ANTP antibody, Anti-ANTP antibody, Dmel_CG1028 antibody, Ant antibody, CG1028 antibody, Scx antibody, DMANTPE1 antibody, DRO15DC96Z antibody, 3.4 antibody, Hu antibody, l(3)84Ba antibody, ANT-P antibody, AntP1 antibody, ANT-C antibody, DmAntp antibody, AntP antibody
Specificity ANTP antibody was raised against the C terminal Of Antp
Cross Reactivity Drosophila
Applications WB
Immunogen ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
Assay Information ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody

Images

Western blot analysis using ANTP antibody (70R-2190)

Recommended Antp Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANTP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ANTP antibody (70R-2190) | Recommended Antp Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors