ANTXR1 antibody (70R-7338)

Rabbit polyclonal ANTXR1 antibody raised against the middle region of ANTXR1

Synonyms Polyclonal ANTXR1 antibody, Anti-ANTXR1 antibody, FLJ11298 antibody, FLJ10601 antibody, FLJ21776 antibody, ATR antibody, Anthrax Toxin Receptor 1 antibody, TEM8 antibody
Specificity ANTXR1 antibody was raised against the middle region of ANTXR1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK
Assay Information ANTXR1 Blocking Peptide, catalog no. 33R-9794, is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Images

Western Blot analysis using ANTXR1 antibody (70R-7338)

ANTXR1 antibody (70R-7338) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANTXR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANTXR1 antibody (70R-7338) | ANTXR1 antibody (70R-7338) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors