AOC2 antibody (retina specific) (70R-7299)

Rabbit polyclonal AOC2 antibody (retina specific)

Synonyms Polyclonal AOC2 antibody (retina specific), Anti-AOC2 antibody (retina specific), RAO antibody, DAO2 antibody, Amine Oxidase Copper Containing 2 antibody
Cross Reactivity Human
Applications WB
Immunogen AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN
Assay Information AOC2 Blocking Peptide (retina specific), catalog no. 33R-1119, is also available for use as a blocking control in assays to test for specificity of this AOC2 antibody (retina specific)


Western Blot analysis using AOC2 antibody (retina specific) (70R-7299)

AOC2 antibody (retina specific) (70R-7299) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AOC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AOC2 antibody (retina specific) (70R-7299) | AOC2 antibody (retina specific) (70R-7299) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors