AP1G1 antibody (70R-3825)

Rabbit polyclonal AP1G1 antibody raised against the C terminal of AP1G1

Synonyms Polyclonal AP1G1 antibody, Anti-AP1G1 antibody, Adaptor-Related Protein Complex 1 Gamma 1 Subunit antibody, AP-1 antibody, ADTG antibody, CLAPG1 antibody, MGC18255 antibody, AP1, AP 1 antibody, AP-1, AP 1
Specificity AP1G1 antibody was raised against the C terminal of AP1G1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AP1G1 antibody was raised using the C terminal of AP1G1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS
Assay Information AP1G1 Blocking Peptide, catalog no. 33R-1979, is also available for use as a blocking control in assays to test for specificity of this AP1G1 antibody

Images

Western blot analysis using AP1G1 antibody (70R-3825)

Recommended AP1G1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AP1G1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using AP1G1 antibody (70R-3825) | Recommended AP1G1 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using AP1G1 antibody (70R-3825) | Tissue analyzed: Jurkat; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using AP1G1 antibody (70R-3825) | Tissue analyzed: HepG2; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using AP1G1 antibody (70R-3825) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors