AP1M2 antibody (70R-4535)

Rabbit polyclonal AP1M2 antibody raised against the N terminal of AP1M2

Synonyms Polyclonal AP1M2 antibody, Anti-AP1M2 antibody, AP 1, AP-1 antibody, MU-1B antibody, MU1B antibody, Adaptor-Related Protein Complex 1 Mu 2 Subunit antibody, AP1, AP 1 antibody, HSMU1B antibody, AP-1
Specificity AP1M2 antibody was raised against the N terminal of AP1M2
Cross Reactivity Human
Applications WB
Immunogen AP1M2 antibody was raised using the N terminal of AP1M2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL
Assay Information AP1M2 Blocking Peptide, catalog no. 33R-6400, is also available for use as a blocking control in assays to test for specificity of this AP1M2 antibody

Images

Western Blot analysis using AP1M2 antibody (70R-4535)

AP1M2 antibody (70R-4535) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AP1M2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AP1M2 antibody (70R-4535) | AP1M2 antibody (70R-4535) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors