AP2B1 antibody (70R-3422)

Rabbit polyclonal AP2B1 antibody raised against the middle region of AP2B1

Synonyms Polyclonal AP2B1 antibody, Anti-AP2B1 antibody, AP-2 antibody, CLAPB1 antibody, AP 2 antibody, AP2-BETA antibody, AP-2, AP2, AP 2, ADTB2 antibody, DKFZp781K0743 antibody, Adaptor-Related Protein Complex 2 Beta 1 Subunit antibody, AP105B antibody
Specificity AP2B1 antibody was raised against the middle region of AP2B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AP2B1 antibody was raised using the middle region of AP2B1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP
Assay Information AP2B1 Blocking Peptide, catalog no. 33R-8408, is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody


Western Blot analysis using AP2B1 antibody (70R-3422)

AP2B1 antibody (70R-3422) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AP2B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AP2B1 antibody (70R-3422) | AP2B1 antibody (70R-3422) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors