AP3S1 antibody (70R-3826)

Rabbit polyclonal AP3S1 antibody raised against the N terminal of AP3S1

Synonyms Polyclonal AP3S1 antibody, Anti-AP3S1 antibody, CLAPS3 antibody, Sigma3A antibody, AP 3, AP 3 antibody, AP3, AP-3, AP-3 antibody, Adaptor-Related Protein Complex 3 Sigma 1 Subunit antibody
Specificity AP3S1 antibody was raised against the N terminal of AP3S1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AP3S1 antibody was raised using the N terminal of AP3S1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE
Assay Information AP3S1 Blocking Peptide, catalog no. 33R-4012, is also available for use as a blocking control in assays to test for specificity of this AP3S1 antibody


Western Blot analysis using AP3S1 antibody (70R-3826)

AP3S1 antibody (70R-3826) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AP3S1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AP3S1 antibody (70R-3826) | AP3S1 antibody (70R-3826) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors