APBB2 antibody (70R-5679)

Rabbit polyclonal APBB2 antibody raised against the middle region of APBB2

Synonyms Polyclonal APBB2 antibody, Anti-APBB2 antibody, FE65L1 antibody, Amyloid Beta A4 Precursor Protein-Binding 2B antibody, MGC35575 antibody, FE65L antibody
Specificity APBB2 antibody was raised against the middle region of APBB2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
Assay Information APBB2 Blocking Peptide, catalog no. 33R-7664, is also available for use as a blocking control in assays to test for specificity of this APBB2 antibody


Western Blot analysis using APBB2 antibody (70R-5679)

APBB2 antibody (70R-5679) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APBB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APBB2 may modulate the internalization of beta-amyloid precursor protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using APBB2 antibody (70R-5679) | APBB2 antibody (70R-5679) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors